Proteintech, 32375-1-AP, USP43 Polyclonal antibody

Size: 20ul / 150ul The USP43 (32375-1-AP) by Proteintech is a Polyclonal antibody targeting USP43 in WB, ELISA applications with reactivity to human samples 32375-1-AP targets USP43 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HaCaT cells, Jurkat cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information USP43 belongs to the DUBs family involved in cancer development and progression.The USPs family is the most recognized group of DUBs, characterized by a wide range of structural and functional variability. The distinguishing features of USPs include the unique catalytic core, known as the histidine and cysteine boxes, as well as the presence of zinc finger domains, ubiquitin-binding domains, or ubiquitin-like domains at the N and/or Ctermini of the catalytic domain (PMID: 16325574). It has 4 isoforms with a molecular weight of 69 kDa, 89 kDa,122 kDa, 123 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36448 Product name: Recombinant human USP43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 900-1123 aa of BC136368 Sequence: CLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQVPPVSLVSGGLSPAMDGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAPRGSALGMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF Predict reactive species Full Name: ubiquitin specific peptidase 43 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC136368 Gene Symbol: USP43 Gene ID (NCBI): 124739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q70EL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.