Iright
BRAND / VENDOR: Proteintech

Proteintech, 32376-1-AP, ELA3B Polyclonal antibody

CATALOG NUMBER: 32376-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ELA3B (32376-1-AP) by Proteintech is a Polyclonal antibody targeting ELA3B in WB, ELISA applications with reactivity to human, mouse, rat samples 32376-1-AP targets ELA3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information ELA3B, or elastase 3B, is a protein encoded by the human ELA3B gene. It belongs to the elastase family of serine proteases, which are enzymes that cleave peptide bonds in proteins. ELA3B is mainly expressed in the pancreas and is involved in the digestion of dietary proteins. Like other elastases, it plays a role in the degradation of elastin, a key component of connective tissue, as well as other extracellular matrix proteins. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36965 Product name: Recombinant human ELA3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-192 aa of BC005216 Sequence: WTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWN Predict reactive species Full Name: elastase 3B, pancreatic Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29-32 kDa GenBank Accession Number: BC005216 Gene Symbol: ELA3B Gene ID (NCBI): 23436 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P08861 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924