Iright
BRAND / VENDOR: Proteintech

Proteintech, 32377-1-AP, RIC1 Polyclonal antibody

CATALOG NUMBER: 32377-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RIC1 (32377-1-AP) by Proteintech is a Polyclonal antibody targeting RIC1 in WB, IP, ELISA applications with reactivity to human samples 32377-1-AP targets RIC1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RIC1 (RAB6A GEF complex partner 1) is a protein that plays a critical role in intracellular membrane trafficking. It encodes a protein of 1056 amino acid (aa) residues, including a putative nuclear localisation sequence (PMID: 9099877). Ric1 is composed of two β-propellers and a C-terminal α-solenoid domain that remodels the Rab6 nucleotide-binding pocket to facilitate nucleotide exchange (PMID: 39632878). RIC1 proteins play important roles in vesicular trafficking, regulation of membrane dynamics, cell division and signalling, and are essential for maintaining normal cellular function. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36426 Product name: Recombinant human KIAA1432 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 820-1054 aa of BC136616 Sequence: QTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTAQEPSSSGGFEFFRNRSISLSQSAENVPASKFSLQKTLSMPSGPSGKRWSKDSDCAENMYIDMMLWRHARRLLEDVRLKDLGCFAAQLGFELISWLCKERTRAARVDNFVIALKRLHKDFLWPLPIIPASSISSP Predict reactive species Full Name: KIAA1432 Observed Molecular Weight: 150 kDa GenBank Accession Number: BC136616 Gene Symbol: KIAA1432 Gene ID (NCBI): 57589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q4ADV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924