Iright
BRAND / VENDOR: Proteintech

Proteintech, 32384-1-AP, SLC7A11/xCT Polyclonal antibody

CATALOG NUMBER: 32384-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC7A11/xCT (32384-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A11/xCT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 32384-1-AP targets SLC7A11/xCT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled HeLa cells, unboiled mouse brain tissue, unboiled rat brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SLC7A11 (also known as xCT) is a membrane transporter involved in cysteine uptake. It promotes glutathione synthesis through cystine uptake and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers, including lung cancer. 32384-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38215 Product name: Recombinant mouse Slc7a11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of NM_011990 Sequence: MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVLKK Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: NM_011990 Gene Symbol: Slc7a11 Gene ID (NCBI): 26570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9WTR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924