Proteintech, 32425-1-AP, EDDM3B Polyclonal antibody

Size: 20ul / 150ul The EDDM3B (32425-1-AP) by Proteintech is a Polyclonal antibody targeting EDDM3B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 32425-1-AP targets EDDM3B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information EDDM3B (Epididymal secretory protein E3-beta), also known as FAM12B, HE3B (Human epididymis-specific protein 3-beta), is highly enriched in the epididymis and is involved in the secretion of glycoproteins that interact with sperm membranes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37630 Product name: Recombinant human EDDM3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-118 aa of NM_022360 Sequence: RENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESR Predict reactive species Full Name: family with sequence similarity 12, member B (epididymal) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: NM_022360 Gene Symbol: FAM12B Gene ID (NCBI): 64184 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P56851 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.