Iright
BRAND / VENDOR: Proteintech

Proteintech, 32429-1-AP, ORC3L Polyclonal antibody

CATALOG NUMBER: 32429-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ORC3L (32429-1-AP) by Proteintech is a Polyclonal antibody targeting ORC3L in WB, ELISA applications with reactivity to human samples 32429-1-AP targets ORC3L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ORC3L, also known as Origin Recognition Complex Subunit 3-like, is a human gene that encodes a protein which is a subunit of the Origin Recognition Complex (ORC). The ORC is a highly conserved six-subunit protein complex that is essential for the initiation of DNA replication in eukaryotic cells. Studies in yeast have shown that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37481 Product name: Recombinant human ORC3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-207 aa of NM_012381.3 Sequence: KPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTS Predict reactive species Full Name: origin recognition complex, subunit 3-like (yeast) Calculated Molecular Weight: 66 kDa, 82 kDa Observed Molecular Weight: 66 kDa, 82 kDa GenBank Accession Number: NM_012381.3 Gene Symbol: ORC3L Gene ID (NCBI): 23595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UBD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924