Iright
BRAND / VENDOR: Proteintech

Proteintech, 32435-1-AP, CD107a / LAMP1 Polyclonal antibody

CATALOG NUMBER: 32435-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD107a / LAMP1 (32435-1-AP) by Proteintech is a Polyclonal antibody targeting CD107a / LAMP1 in WB, IF/ICC, ELISA applications with reactivity to mouse, rat samples 32435-1-AP targets CD107a / LAMP1 in WB, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, C6 cells, HSC-T6 cells, rat kidney tissue, RAW 264.7 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information LAMP1 (also known as CD107a) is a 90-120 kDa heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34623 Product name: Recombinant mouse Lamp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of NM_001317353 Sequence: MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGP Predict reactive species Full Name: lysosomal-associated membrane protein 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 90-120 kDa GenBank Accession Number: NM_001317353 Gene Symbol: CD107a Gene ID (NCBI): 16783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P11438 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924