Proteintech, 32439-1-AP, ABHD17A Polyclonal antibody

Size: 20ul / 150ul The ABHD17A (32439-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD17A in WB, ELISA applications with reactivity to human, mouse, rat samples 32439-1-AP targets ABHD17A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Alpha/beta hydrolase domain-containing protein 17A (ABHD17A), also known as FAM108A, is a membrane-localized thioesterase, which regulates H- and N-RAS39, also catalyzes the depalmitoylation of CNAβ1 causing it to redistribute from the PM to the cytosol and the Golgi (PMID: 34663815). ABHD17a is a major acyl protein thioesterase that site-specifically deacylates the STREX domain of the BK channel to control channel activity (PMID: 32913120). Western blot analysis detected ABHD17A at an apparent molecular mass of 34 kDa (PMID: 27307232), and the 70 kDa-band could be the dimer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36531 Product name: Recombinant human FAM108A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-115 aa of BC000158 Sequence: EATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNHVSCMYVRCVPGARYTVL Predict reactive species Full Name: family with sequence similarity 108, member A1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000158 Gene Symbol: ABHD17A Gene ID (NCBI): 81926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96GS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.