Iright
BRAND / VENDOR: Proteintech

Proteintech, 32442-1-AP, Ficolin 2 Polyclonal antibody

CATALOG NUMBER: 32442-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Ficolin 2 (32442-1-AP) by Proteintech is a Polyclonal antibody targeting Ficolin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32442-1-AP targets Ficolin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat lung tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles in the immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin 2 recognizes pathogen-associated pattern molecules (PAMPs) on the surface of pathogenic microorganisms, activates the complement lectin pathway, and binds to mannose-binding lectin-associated serine proteases (MASPs) to exert immune defense function (PMID: 21315829). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37525 Product name: Recombinant human FCN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-288 aa of NM_004108 Sequence: EGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFA Predict reactive species Full Name: ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34-35 kDa GenBank Accession Number: NM_004108 Gene Symbol: FCN2 Gene ID (NCBI): 2220 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15485 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924