Iright
BRAND / VENDOR: Proteintech

Proteintech, 32476-1-AP, IPO8 Polyclonal antibody

CATALOG NUMBER: 32476-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IPO8 (32476-1-AP) by Proteintech is a Polyclonal antibody targeting IPO8 in WB, ELISA applications with reactivity to human, mouse samples 32476-1-AP targets IPO8 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, MDA-MB-231 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information IPO8(Importin 8) is a gene encoding protein, which is located on human chromosome 12. It belongs to the nuclear protein transport family, and is mainly involved in the process of nuclear protein introduction. IPO8 regulates the transport function of nuclear pore complex by interacting with Ran GTPase and other proteins (PMID: 11682607). It is expected to be located in the cytoplasm and nucleus. IPO8 is associated with many diseases, including VISS syndrome and Loeys-Dietz syndrome. These diseases usually involve cardiovascular defects, skeletal abnormalities and immune loss. The molecular weight of PO8 protein is about 125kDa, and its structure includes helix and β-sheet. It has a specific three-dimensional structure and can form complexes with other protein. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35395 Product name: Recombinant human IPO8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 870-1037 aa of BC167853 Sequence: LGLKQVCATRQLVNREDRSKAEKADMEENEEISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN Predict reactive species Full Name: importin 8 Observed Molecular Weight: 120-125 kDa GenBank Accession Number: BC167853 Gene Symbol: IPO8 Gene ID (NCBI): 10526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O15397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924