Proteintech, 32502-1-AP, CXCL2 Polyclonal antibody

Size: 20ul / 150ul The CXCL2 (32502-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL2 in WB, FC (Intra), ELISA applications with reactivity to mouse samples 32502-1-AP targets CXCL2 in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells Positive FC (Intra) detected in: LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 2 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_009140 Gene Symbol: Cxcl2 Gene ID (NCBI): 20310 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P10889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.