Proteintech, 32511-1-AP, SVIP Polyclonal antibody

Size: 20ul / 150ul The SVIP (32511-1-AP) by Proteintech is a Polyclonal antibody targeting SVIP in WB, ELISA applications with reactivity to human, mouse, rat samples 32511-1-AP targets SVIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PANC-1 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SVIP (Small VCP-interacting protein) is a 9-Kda adaptor endoplasmic reticulum protein that could bind directly to p97/VCP. SVIP is located on the ER membrane's cytosolic surface. It inhibits the ERAD pathway, which is known independently of ubiquitin, by interacting with p97/VCP, which has a central role in this pathway. Especially for the ERAD pathway, the SVIP protein has been identified as a negative regulator. SVIP was identified as a novel adapter protein for p97/VCP by observing its overexpression in cells, which causes extensive vacuolation and deformation of the ER and microtubules (PMID: 39473740). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36618 Product name: Recombinant human SVIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of NM_001320340 Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS Predict reactive species Full Name: small VCP/p97-interacting protein Calculated Molecular Weight: 8kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: NM_001320340 Gene Symbol: SVIP Gene ID (NCBI): 258010 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NHG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.