Iright
BRAND / VENDOR: Proteintech

Proteintech, 32517-1-AP, SPATS2 Polyclonal antibody

CATALOG NUMBER: 32517-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPATS2 (32517-1-AP) by Proteintech is a Polyclonal antibody targeting SPATS2 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 32517-1-AP targets SPATS2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPATS2, also known as SCR59 and SPATA10, is a member of the RNA-binding proteins whose aberrant expression is associated with carcinogenesis in several types of cancer. It is mainly expressed in the adult testis, with low expression in liver and other tissues (PMID: 33037180). The apparent molecular weight is higher than the calculated molecular weight of 60 kDa, probably due to post-translational modification, probably by phosphorylation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38507 Product name: Recombinant human SPATS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-240 aa of NM_001293285.1 Sequence: NKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEK Predict reactive species Full Name: spermatogenesis associated, serine-rich 2 Calculated Molecular Weight: 60kDa,545aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001293285.1 Gene Symbol: SPATS2 Gene ID (NCBI): 65244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86XZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924