Proteintech, 32562-1-AP, FAM50B Polyclonal antibody

Size: 20ul / 150ul The FAM50B (32562-1-AP) by Proteintech is a Polyclonal antibody targeting FAM50B in WB, ELISA applications with reactivity to human samples 32562-1-AP targets FAM50B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, U-87 MG cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FAM50B, also known as family with sequence similarity 50, member B, is a protein-coding gene located on chromosome 6. It is widely expressed in various tissues, with particularly high abundance in the testis and both adult and fetal brain. The exact function of FAM50B is not yet fully understood and is still under investigation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38226 Product name: Recombinant human FAM50B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-141 aa of NM_012135.2 Sequence: MKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGN Predict reactive species Full Name: family with sequence similarity 50, member B Calculated Molecular Weight: 39kDa，325aa Observed Molecular Weight: 38 kDa GenBank Accession Number: NM_012135.2 Gene Symbol: FAM50B Gene ID (NCBI): 26240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.