Iright
BRAND / VENDOR: Proteintech

Proteintech, 32583-1-AP, ZSCAN1 Polyclonal antibody

CATALOG NUMBER: 32583-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZSCAN1 (32583-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 32583-1-AP targets ZSCAN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue, mouse testis tissue, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ZSCAN1 is a transcription factor containing a zinc finger domain and a SCAN domain. ZSCAN1 has been implicated in diverse biological processes. It has been shown to act as a stemness-related tumor suppressor and transcriptional repressor in breast cancer, targeting TAZ to influence cancer progression. Additionally, ZSCAN1 is involved in early embryonic development, where it helps regulate the expression of genes necessary for proper embryogenesis. It also plays a role in the immune response, with anti-ZSCAN1 autoantibodies being identified as potential diagnostic markers for certain syndromes like ROHHAD (PMID: 38339072). According to Human Protein Atlas database, ZSCAN1 is mainly expressed in brain, pituitary gland and testis tissue. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37955 Product name: Recombinant human ZSCAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-400 aa of NM_182572 Sequence: HQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK Predict reactive species Full Name: zinc finger and SCAN domain containing 1 Calculated Molecular Weight: 408 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_182572 Gene Symbol: ZSCAN1 Gene ID (NCBI): 284312 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NBB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924