Proteintech, 32584-1-AP, WASF1 Polyclonal antibody

Size: 20ul / 150ul The WASF1 (32584-1-AP) by Proteintech is a Polyclonal antibody targeting WASF1 in WB, IP, ELISA applications with reactivity to human samples 32584-1-AP targets WASF1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information WASF1 (Wiskott-Aldrich Syndrome Protein Family Member 1) is a gene encoding an actin-binding protein that belongs to the Wiskott-Aldrich syndrome protein family. It is primarily involved in regulating the reorganization of the actin cytoskeleton in cells, and is essential for processes such as cell morphology, motility, and signaling. WASF1 promotes actin polymerization by interacting with the Arp2/3 complex, thereby affecting cell deformation and migration. WASF1 is expressed in a variety of cell types, including tissues such as brain and testis. Its aberrant expression is associated with a variety of diseases, such as tumor invasion and metastasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38505 Product name: Recombinant human WASF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-320 aa of NM_003931.2 Sequence: KQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFV Predict reactive species Full Name: WAS protein family, member 1 Calculated Molecular Weight: 62kDa，559aa Observed Molecular Weight: 75 kDa GenBank Accession Number: NM_003931.2 Gene Symbol: WASF1 Gene ID (NCBI): 8936 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q92558 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.