Iright
BRAND / VENDOR: Proteintech

Proteintech, 32594-1-AP, HSF2BP Polyclonal antibody

CATALOG NUMBER: 32594-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HSF2BP (32594-1-AP) by Proteintech is a Polyclonal antibody targeting HSF2BP in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32594-1-AP targets HSF2BP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Heat shock factor 2-binding protein (HSF2BP, also known as MEILB2) is a binding protein of HSF2, which is involved in modulating HSF2 activation in testis (PMID: 9651507). Naturally occurring elevated production of HSF2BP in tumors may be a source of cancer-promoting genomic instability and a vulnerable target (PMID: 31960047; 34790765). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37637 Product name: Recombinant human HSF2BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC000153 Sequence: MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV Predict reactive species Full Name: heat shock transcription factor 2 binding protein Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC000153 Gene Symbol: HSF2BP Gene ID (NCBI): 11077 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75031 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924