Iright
BRAND / VENDOR: Proteintech

Proteintech, 32611-1-AP, IL-16 Polyclonal antibody

CATALOG NUMBER: 32611-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-16 (32611-1-AP) by Proteintech is a Polyclonal antibody targeting IL-16 in WB, ELISA applications with reactivity to mouse samples 32611-1-AP targets IL-16 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Pro-IL-16 can be detected at about 80 kDa, and cleaved fragments can be deteced at between 40 and 75 kDa. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3127 Product name: Recombinant Mouse IL-16 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1205-1322 aa of NM_010551.3 Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS Predict reactive species Full Name: interleukin 16 Calculated Molecular Weight: 141 kDa Observed Molecular Weight: 66-72 kDa GenBank Accession Number: NM_010551.3 Gene Symbol: Il16 Gene ID (NCBI): 16170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O54824-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924