Iright
BRAND / VENDOR: Proteintech

Proteintech, 32645-1-AP, GLMN Polyclonal antibody

CATALOG NUMBER: 32645-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GLMN (32645-1-AP) by Proteintech is a Polyclonal antibody targeting GLMN in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32645-1-AP targets GLMN in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, Jurkat cells, mouse retina tissue, rat eye tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Glomulin (GLMN) is a regulatory component of cullin-RING-based SCF (SKP1-Cullin-F-box protein) E3 ubiquitin-protein ligase complexes (PMID: 22405651; 22748924). It inhibits E3 ubiquitin ligase activity by binding to RBX1 (via the RING domain) and inhibiting its interaction with the E2 ubiquitin-conjugating enzyme CDC34 (PMID: 22405651; 22748924). GLMN is essential for normal vasculature development and contributes to the regulation of RPS6KB1 phosphorylation (PMID: 11845407; 11571281). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37763 Product name: Recombinant human GLMN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 241-594 aa of BC001257 Sequence: ASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK Predict reactive species Full Name: glomulin, FKBP associated protein Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC001257 Gene Symbol: GLMN Gene ID (NCBI): 11146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q92990 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924