Iright
BRAND / VENDOR: Proteintech

Proteintech, 32668-1-AP, CD59 Polyclonal antibody

CATALOG NUMBER: 32668-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD59 (32668-1-AP) by Proteintech is a Polyclonal antibody targeting CD59 in WB, IHC, ELISA applications with reactivity to rat samples 32668-1-AP targets CD59 in WB, IHC, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat lung tissue Positive IHC detected in: rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3220 Product name: Recombinant Rat CD59 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-101 aa of Sequence: NCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNN Predict reactive species Full Name: CD59 molecule, complement regulatory protein Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 20 kDa Gene Symbol: Cd59 Gene ID (NCBI): 25407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P27274 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924