Proteintech, 32675-1-AP, Complement factor D Polyclonal antibody

Size: 20ul / 150ul The Complement factor D (32675-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor D in WB, ELISA applications with reactivity to mouse, rat samples 32675-1-AP targets Complement factor D in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse serum, rat plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Complement factor D, also known as adipsin, is a highly specific serine protease. Complement factor D is the rate-limiting enzyme in the alternative pathway of complement. It activates C3 convertase by cleaving factor B, which is a key step in the alternative pathway. Complement factor D catalyzes the cleavage of factor B to generate Ba (non-catalytic chain) and Bb (active catalytic subunit), which together with C3(H2O) (or C3b) constitute the active C3 convertase C3(H2O)Bb (or C3bBb). (PMID: 34566967; PMID: 27775713). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3077 Product name: Recombinant Mouse Cfd protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-259 aa of NM_013459.4 Sequence: QPRGRILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS Predict reactive species Full Name: complement factor D (adipsin) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: NM_013459.4 Gene Symbol: Cfd Gene ID (NCBI): 11537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P03953-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.