Iright
BRAND / VENDOR: Proteintech

Proteintech, 32694-1-AP, NLRP4 Polyclonal antibody

CATALOG NUMBER: 32694-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NLRP4 (32694-1-AP) by Proteintech is a Polyclonal antibody targeting NLRP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 32694-1-AP targets NLRP4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NLRP4 is a member of the NOD-like receptor (NLR) family, a group of intracellular pattern recognition receptors (PRRs) that play crucial roles in innate immunity, inflammation, and cell death regulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38545 Product name: Recombinant human NLRP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-200 aa of NM_134444.4 Sequence: LMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIHLYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRDRFLYTFYFCCRELRELPPTS Predict reactive species Full Name: NLR family, pyrin domain containing 4 Calculated Molecular Weight: 113kDa,994aa Observed Molecular Weight: 98-105 kDa GenBank Accession Number: NM_134444.4 Gene Symbol: NLRP4 Gene ID (NCBI): 147945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96MN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924