Proteintech, 32695-1-AP, COPS7B Polyclonal antibody

Size: 20ul / 150ul The COPS7B (32695-1-AP) by Proteintech is a Polyclonal antibody targeting COPS7B in WB, ELISA applications with reactivity to human, mouse, rat samples 32695-1-AP targets COPS7B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information COP9 signalosome complex subunit 7b (COPS7B, also known as CSN7B) is a component of the ribo-interactome that interacts with ribosomes to facilitate ribosome biogenesis and mRNA translation initiation (PMID: 27903243). Increased expression of COPS7B mediated by IGF2BP3 elevates the translational efficiency of genes enriched in mRNA translation and ribosome biogenesis pathways, promoting protein synthesis and driving progression in colorectal cancer (PMID: 37560971). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38543 Product name: Recombinant human COPS7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-264 aa of NM_022730.3 Sequence: TIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH* Predict reactive species Full Name: COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis) Calculated Molecular Weight: 30 kDa，264 aa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_022730.3 Gene Symbol: COPS7B Gene ID (NCBI): 64708 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H9Q2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.