Proteintech, 32706-1-AP, ORAOV1 Polyclonal antibody

Size: 20ul / 150ul The ORAOV1 (32706-1-AP) by Proteintech is a Polyclonal antibody targeting ORAOV1 in IP, ELISA applications with reactivity to human samples 32706-1-AP targets ORAOV1 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: A431 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ORAOV1 (oral cancer overexpressed 1) is a candidate proto-oncogene that is frequently amplified and overexpressed in various human squamous cell carcinomas (SCCs), including oral, esophageal, and cervical cancers. In cervical cancer, silencing of ORAOV1 significantly inhibits the growth of HeLa cells by causing S-phase cell cycle arrest and activating apoptosis. Additionally, ORAOV1 is overexpressed in a variety of solid tumors and may promote tumor development by preventing ribosomal damage induced by reactive oxygen species (ROS). Therefore, ORAOV1 is not only an important tumor biomarker but also a potential therapeutic target for multiple cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38523 Product name: Recombinant human ORAOV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of NM_153451.2 Sequence: MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF Predict reactive species Full Name: oral cancer overexpressed 1 Calculated Molecular Weight: 15kDa，137aa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_153451.2 Gene Symbol: ORAOV1 Gene ID (NCBI): 220064 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WV07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.