Proteintech, 32710-1-AP, UCP1 Polyclonal antibody

Size: 20ul / 150ul The UCP1 (32710-1-AP) by Proteintech is a Polyclonal antibody targeting UCP1 in WB, IHC, ELISA applications with reactivity to mouse samples 32710-1-AP targets UCP1 in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brown adipose tissue Positive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38217 Product name: Recombinant mouse Ucp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-178 aa of BC012701 Sequence: DSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTT Predict reactive species Full Name: uncoupling protein 1 (mitochondrial, proton carrier) Observed Molecular Weight: 35 kDa GenBank Accession Number: BC012701 Gene Symbol: Ucp1 Gene ID (NCBI): 22227 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P12242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.