Iright
BRAND / VENDOR: Proteintech

Proteintech, 32773-1-AP, Mesothelin Polyclonal antibody

CATALOG NUMBER: 32773-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Mesothelin (32773-1-AP) by Proteintech is a Polyclonal antibody targeting Mesothelin in WB, ELISA applications with reactivity to human, mouse samples 32773-1-AP targets Mesothelin in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MKN-45 cells, HeLa cells, SW 1990 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Mesothelin (MSLN) is a cell surface glycoprotein that was discovered in 1992 by Kai Chang, Ira Pastan, and Mark Willingham at the National Cancer Institute in Bethesda, MD. It is synthesized as a 69-kDa precursor protein, which is cleaved to form two proteins: a membrane-bound MSLN and a soluble megakaryocyte potentiating factor (MPF). MSLN is overexpressed in various tumor types, including mesothelioma, ovarian cancer, pancreatic adenocarcinoma, gastric cancer, and triple-negative breast cancer (TNBC). However, it is expressed at low levels in normal tissues, primarily on the mesothelial cells lining the pleura, pericardium, and peritoneum. (PMID: 37869242) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2864 Product name: Recombinant Mouse Mesothelin protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 298-600 aa of NM_018857.1 Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS Predict reactive species Full Name: mesothelin Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 46 kDa, 70 kDa GenBank Accession Number: NM_018857.1 Gene Symbol: Msln Gene ID (NCBI): 56047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q61468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924