Proteintech, 32776-1-AP, KIR2DS1/CD158h Polyclonal antibody

Size: 20ul / 150ul The KIR2DS1/CD158h (32776-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DS1/CD158h in IHC, ELISA applications with reactivity to human samples 32776-1-AP targets KIR2DS1/CD158h in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Killer cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DS1, also known as CD158h, is a 50 kDa, single-pass glycoprotein consisting of an extracellular region composed of two Ig-like domains, a transmembrane region and a short cytoplasmic tail lacking the ITIM motif (PMID: 8627176). It is expressed on natural killer cells and a subset of T cells. KIR2DS1 is an activating receptor that recognizes HLA-C2 group. KIR2DS1 has been shown to be involved in many disorders including autoimmune diseases, malignancies and pregnancy outcomes (PMID: 28546555). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3717 Product name: recombinant human CD158H/KIR2DS1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-245 aa of NM_014512.1 Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH Predict reactive species Full Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 Calculated Molecular Weight: 34 kDa GenBank Accession Number: NM_014512.1 Gene Symbol: KIR2DS1 Gene ID (NCBI): 3806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q14954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.