Proteintech, 32785-1-AP, FAM3D Polyclonal antibody

Size: 20ul / 150ul The FAM3D (32785-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3D in WB, IHC, ELISA applications with reactivity to mouse, rat samples 32785-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information FAM3D (family with sequence similarity 3, member D) is a protein that belongs to the FAM3 family, which is a novel cytokine-like gene family identified in 2002. This family comprises four members: FAM3A, FAM3B, FAM3C, and FAM3D. FAM3D is a gut-secreted protein that is regulated by nutritional status. It has a predicted secondary structure of a four-helix bundle, which is a common feature in many other cytokines. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2694 Product name: recombinant mouse Oit1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-223 aa of NM_146050.2 Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM Predict reactive species Full Name: oncoprotein induced transcript 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_146050.2 Gene Symbol: Oit1 Gene ID (NCBI): 18300 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P97805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.