Proteintech, 32786-1-AP, Resistin Polyclonal antibody

Size: 20ul / 150ul The Resistin (32786-1-AP) by Proteintech is a Polyclonal antibody targeting Resistin in WB, ELISA applications with reactivity to mouse samples 32786-1-AP targets Resistin in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse adipose tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Resistin, an adipokine produced in fat tissue, is a cysteine rich protein with a molecular weight of 12 kDa. Resistin inhibits insulin action, signaling, and glucose metabolism. Previous data have suggested that resistin secretion is linked to insulin resistance (IR) and type 2 diabetes. Resistin expression in rodents is limited only to adipocytes, but human resistin is produced mainly by macrophages and monocytes, which show only 59% amino acid homology to mice. (PMID: 34325643, PMID: 32991315) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3391 Product name: Recombinant Mouse Resistin protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-114 aa of NM_001204959.1 Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS Predict reactive species Full Name: resistin Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: NM_001204959.1 Gene Symbol: Retn Gene ID (NCBI): 57264 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q99P87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.