Proteintech, 32809-1-AP, Cathepsin B Polyclonal antibody

Size: 20ul / 150ul The Cathepsin B (32809-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin B in WB, ELISA applications with reactivity to mouse samples 32809-1-AP targets Cathepsin B in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse brain tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 39 kDa form of pro-CTSB, 31 kDa mature forms in mouse brain by western blot. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3028 Product name: Recombinant Mouse Ctsb protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-339 aa of NM_007798.3 Sequence: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF Predict reactive species Full Name: cathepsin B Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 31 kDa, 39 kDa GenBank Accession Number: NM_007798.3 Gene Symbol: Ctsb Gene ID (NCBI): 13030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P10605 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.