Iright
BRAND / VENDOR: Proteintech

Proteintech, 32836-1-AP, ITFG2 Polyclonal antibody

CATALOG NUMBER: 32836-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ITFG2 (32836-1-AP) by Proteintech is a Polyclonal antibody targeting ITFG2 in WB, ELISA applications with reactivity to human samples 32836-1-AP targets ITFG2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Integrin-alpha FG-GAP repeat-containing protein 2 (ITFG2) is an immune-modulatory intracellular protein that modulates the fate of B cells and negatively regulates mTORC1 signaling (PMID: 23997217; 28199306). ITFG2 is highly expressed in the heart, which may be a novel strategy for the clinical management of myocardial infarction (PMID: 38848780). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36829 Product name: Recombinant human ITFG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-362 aa of BC006552 Sequence: LLCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCTLDGTLKLMEEMEEADKLLWSVQVDHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKE Predict reactive species Full Name: integrin alpha FG-GAP repeat containing 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC006552 Gene Symbol: ITFG2 Gene ID (NCBI): 55846 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q969R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924