Iright
BRAND / VENDOR: Proteintech

Proteintech, 32839-1-AP, PGBD2 Polyclonal antibody

CATALOG NUMBER: 32839-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PGBD2 (32839-1-AP) by Proteintech is a Polyclonal antibody targeting PGBD2 in WB, ELISA applications with reactivity to human samples 32839-1-AP targets PGBD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, MDA-MB-231 cells, Raji cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. Two transcript variants encoding different isoforms have been found for this gene. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38500 Product name: Recombinant human PGBD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_170725.2 Sequence: MASTSRDVIAGRGIHSKVKSAKLLEVLNAMEEEESNNNREEIFIAPPDNAAGEFTDEDSGDEDSQRGAHLPGSVLHASVLCEDSGTGEDNDDLELQPAKKRQKAVVKPQRIWTKRDIRPDFGSWTASDPHIEDLKSQELSPVGLFELFFD Predict reactive species Full Name: piggyBac transposable element derived 2 Calculated Molecular Weight: 68kDa,592aa Observed Molecular Weight: 71 kDa GenBank Accession Number: NM_170725.2 Gene Symbol: PGBD2 Gene ID (NCBI): 267002 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6P3X8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924