Proteintech, 32853-1-AP, BMP2K Polyclonal antibody

Size: 20ul / 150ul The BMP2K (32853-1-AP) by Proteintech is a Polyclonal antibody targeting BMP2K in WB, ELISA applications with reactivity to human samples 32853-1-AP targets BMP2K in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information BMP2K is an uncharacterized member of NAK family. Structural similarities of kinase domains (75% identical) and in vitro inhibition profiles categorized BMP2K as the closest homolog of AAK1. BMP2K was originally identified as a serine-threonine kinase regulating osteoblast differentiation whose gene product is sharply upregulated by BMP-2 stimulation. Later, various genetic and proteomic screens linked BMP2K to HIV entry, developmental dysplasia of the hip, myopia, leukemia, breast cancer metastasis and so on. Recent multivariate proteomic profiling approaches identified BMP2K as a component of purified CCV from HeLa cells. BMP2K can phosphorylate AP-2 in vitro and in vivo. Functional impairment of BMP2K impedes AP-2 phosphorylation leading to defects in clathrin-coated pit (CCP) morphology and cargo internalization. BMP2K engages AP-2 via its extended C-terminus and this interaction is important for its CCP localization and function (PMID: 34480404). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36482 Product name: Recombinant human BMP2K protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 495-650 aa of NM_198892.1 Sequence: LLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS Predict reactive species Full Name: BMP2 inducible kinase Calculated Molecular Weight: 129kDa，1161aa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_198892.1 Gene Symbol: BMP2K Gene ID (NCBI): 55589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NSY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.