Proteintech, 32856-1-AP, NACA4P Polyclonal antibody

Size: 20ul / 150ul The NACA4P (32856-1-AP) by Proteintech is a Polyclonal antibody targeting NACA4P in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 32856-1-AP targets NACA4P in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: rat testis tissue Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue, rat testis tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information NACA4P (Nasal Associated Albumin 4 Pseudogene) is classified as a pseudogene, originating from the duplication of the functional gene NACA but itself does not encode a functional protein. Modern research has revealed that the transcript of NACA4P functions as a long non-coding RNA (lncRNA) and plays a critical regulatory role in various biological processes. Its expression is low in normal tissues but is significantly upregulated in multiple cancers (such as liver cancer, gastric cancer, and colorectal cancer). By acting as a competitive endogenous RNA (ceRNA) "sponge" that sequesters specific microRNAs, it influences the expression of downstream oncogenes, thereby promoting tumor cell proliferation, migration, and inhibiting apoptosis. Consequently, NACA4P is widely investigated as a potential diagnostic biomarker and therapeutic target in oncology, highlighting the important functional role of pseudogenes in cancer biology. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37692 Product name: Recombinant human NACAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC069411 Sequence: MPGEATETVPAIEQQLLQPQAETGSGTESDSDESVPELEEQDSTQVTAQVQLVVAAEIDEEPVSKAKQRRSEKKARKARFKLGLQQVTGVTRVTIRKSKNILFVITKPDVYKSP Predict reactive species Full Name: nascent-polypeptide-associated complex alpha polypeptide pseudogene 1 Calculated Molecular Weight: 213 aa, 23 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC069411 Gene Symbol: NACAP1 Gene ID (NCBI): 83955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.