Proteintech, 32859-1-AP, HCRTR2 Polyclonal antibody

Size: 20ul / 150ul The HCRTR2 (32859-1-AP) by Proteintech is a Polyclonal antibody targeting HCRTR2 in WB, ELISA applications with reactivity to human, mouse samples 32859-1-AP targets HCRTR2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C6 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38128 Product name: Recombinant human HCRTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-444 aa of NM_001526 Sequence: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW Predict reactive species Full Name: hypocretin (orexin) receptor 2 Calculated Molecular Weight: 440aa, 51 kDa Observed Molecular Weight: 70-73 kDa GenBank Accession Number: NM_001526 Gene Symbol: HCRTR2 Gene ID (NCBI): 3062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43614 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.