Proteintech, 32879-1-AP, OVCH1 Polyclonal antibody

Size: 20ul / 150ul The OVCH1 (32879-1-AP) by Proteintech is a Polyclonal antibody targeting OVCH1 in WB, ELISA applications with reactivity to human samples 32879-1-AP targets OVCH1 in applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEL cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information OVCH1 (Ovochymase 1) is a secretory protein that belongs to the serine protease family and is predicted to have metal ion binding activity and serine-type endopeptidase activity. It is involved in the proteolysis process and functions within the plasma membrane. OVCH1 contains CUB domains and a Trypsin-like serine protease domain, which suggest that OVCH1 may play a role in development. Additionally, genetic variations in the OVCH1 gene may affect its function, thereby influencing individual phenotypes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37723 Product name: Recombinant human OVCH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 785-1134 aa of BC156869 Sequence: GAGCVQPWKPGVFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPPPTPSPDSASWPGCCSEAELEKPRGFFPTPRYLLDYRGRLECSWVLRVSASSMAKFTIEYLSLLGSPVCQDSVLIIYEERHSKRKTAGGLHGRRLYSMTFMSPGPLVRVTFHALVRGAFGISYIVLKVLGPKDSKITRLSQSSNREHLVPCEDVLLTKPEGIMQIPRNSHRTTMGCQWRLVAPLNHIIQLNIINFPMKPTTFVCHGHLRVYEGFGPGKKLIASFAGTLAMILTKDILKREKLNFINTYIMHIWENSVYDNVRSVGKRKQKKFASNLSYSMEAEKSRIQVPADLVPAKGSLSGS Predict reactive species Full Name: ovochymase 1 Calculated Molecular Weight: 1134 aa, 125 kDa Observed Molecular Weight: 125-135 kDa GenBank Accession Number: BC156869 Gene Symbol: OVCH1 Gene ID (NCBI): 341350 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7RTY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.