Iright
BRAND / VENDOR: Proteintech

Proteintech, 32898-1-AP, KCTD4 Polyclonal antibody

CATALOG NUMBER: 32898-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KCTD4 (32898-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD4 in WB, ELISA applications with reactivity to human, mouse, rat samples 32898-1-AP targets KCTD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The family of potassium channel tetramerization domain (KCTD) proteins consists of 26 members (PMID: 24268103). Potassium channel tetramerization domain containing 4 (KCTD4) is a protein that interacts with CLIC1 to disrupt calcium homeostasis and promote metastasis in esophageal cancer. KCTD4 expression is upregulated in metastatic esophageal squamous cell carcinoma (ESCC), and high KCTD4 expression is associated with poor prognosis in patients with ESCC. This process activates fibroblasts in a paracrine manner, promoting cancer cell invasion via MMP24 signaling as positive feedback (PMID: 37799381). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37112 Product name: Recombinant human KCTD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC018063 Sequence: MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK Predict reactive species Full Name: potassium channel tetramerisation domain containing 4 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC018063 Gene Symbol: KCTD4 Gene ID (NCBI): 386618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WVF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924