Proteintech, 32915-1-AP, TBKBP1 Polyclonal antibody

Size: 20ul / 150ul The TBKBP1 (32915-1-AP) by Proteintech is a Polyclonal antibody targeting TBKBP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 32915-1-AP targets TBKBP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38233 Product name: Recombinant human TBKBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-350 aa of NM_014726.2 Sequence: LQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSP Predict reactive species Full Name: TBK1 binding protein 1 Calculated Molecular Weight: 68kDa，615aa Observed Molecular Weight: 80 kDa GenBank Accession Number: NM_014726.2 Gene Symbol: TBKBP1 Gene ID (NCBI): 9755 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A7MCY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.