Iright
BRAND / VENDOR: Proteintech

Proteintech, 32926-1-AP, CTNNAL1 Polyclonal antibody

CATALOG NUMBER: 32926-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CTNNAL1 (32926-1-AP) by Proteintech is a Polyclonal antibody targeting CTNNAL1 in WB, ELISA applications with reactivity to human samples 32926-1-AP targets CTNNAL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HepG2 cells, HeLa cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Catenin alpha-like protein 1 (CTNNAL1, also known as alpha-catulin) is a cytoplasmic molecule that integrates the crosstalk between nuclear factor-kappa B (NF-κB) and Rho signaling pathways. It plays a crucial role in maintaining epithelial integrity and promoting wound repair in bronchial epithelial cells. CTNNAL1 has been shown to inhibit ozone-induced airway epithelial-mesenchymal transition and regulate mucus hypersecretion induced by house dust mite (HDM) (PMID: 38602002). Additionally, CTNNAL1 promotes the structural integrity of bronchial epithelial cells through the RhoA/ROCK1 pathway (PMID: 36535402). In cancer, CTNNAL1 regulates cancer stem cells (CSCs) in lung cancer and glioblastoma, modulating their migration and invasion abilities (PMID: 37239133). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38629 Product name: Recombinant human CTNNAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-535 aa of NM_003798 Sequence: ISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYG Predict reactive species Full Name: catenin (cadherin-associated protein), alpha-like 1 Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: NM_003798 Gene Symbol: CTNNAL1 Gene ID (NCBI): 8727 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UBT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924