Iright
BRAND / VENDOR: Proteintech

Proteintech, 32945-1-AP, AP3S1 Polyclonal antibody

CATALOG NUMBER: 32945-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AP3S1 (32945-1-AP) by Proteintech is a Polyclonal antibody targeting AP3S1 in WB, IF-P, ELISA applications with reactivity to human samples 32945-1-AP targets AP3S1 in WB, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information AP-3 complex subunit sigma-1 (AP3S1) is a component of the heterotetrameric adaptor protein complex-3 (AP-3), which plays a central role in intracellular protein trafficking (PMID: 34565296). AP3S1 is also a potential pan-cancer oncogene and plays an essential role in tumorigenesis and cancer immunity. Elevated expression of AP3S1 indicates an immunosuppressive microenvironment and can be used as a potential prognostic biomarker and a target for immunotherapy (PMID: 35874816; 38609993). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37523 Product name: Recombinant human AP3S1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC000804 Sequence: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK Predict reactive species Full Name: adaptor-related protein complex 3, sigma 1 subunit Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC000804 Gene Symbol: AP3S1 Gene ID (NCBI): 1176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q92572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924