Proteintech, 32956-1-AP, RNF185 Polyclonal antibody

Size: 20ul / 150ul The RNF185 (32956-1-AP) by Proteintech is a Polyclonal antibody targeting RNF185 in WB, ELISA applications with reactivity to human, mouse, rat samples 32956-1-AP targets RNF185 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RNF185 is a RING finger domain-containing ubiquitin ligase implicated in ER-associated degradation. It is the MOM E3 ligase responsible for regulation of mitochondrial autophagy (PMID: 21931693). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38937 Product name: Recombinant human RNF185 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of NM_152267.3 Sequence: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD Predict reactive species Full Name: ring finger protein 185 Calculated Molecular Weight: 20kDa，192aa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_152267.3 Gene Symbol: RNF185 Gene ID (NCBI): 91445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96GF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.