Proteintech, 32970-1-AP, ADAM11 Polyclonal antibody

Size: 20ul / 150ul The ADAM11 (32970-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM11 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 32970-1-AP targets ADAM11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat cerebellum tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ADAM11 (A Disintegrin And Metalloprotease 11) is a non-catalytic, transmembrane member of the ADAM family. Although it retains the prototypical multi-domain architecture (signal peptide ‑ pro‑domain ‑ metalloprotease-like ‑ disintegrin ‑ cysteine-rich ‑ EGF-like ‑ TM ‑ cytoplasmic tail), it lacks the consensus HEXGHXXGXXHD zinc-binding motif, rendering it proteolytically inactive . Instead, ADAM11 functions as a cell-adhesion and signalling scaffold. (PMID: 31236626) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35877 Product name: Recombinant human ADAM11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-300 aa of NM_001318933 Sequence: STCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ Predict reactive species Full Name: ADAM metallopeptidase domain 11 Calculated Molecular Weight: 83kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: NM_001318933 Gene Symbol: ADAM11 Gene ID (NCBI): 4185 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75078 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.