Iright
BRAND / VENDOR: Proteintech

Proteintech, 32971-1-AP, RBPMS2 Polyclonal antibody

CATALOG NUMBER: 32971-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBPMS2 (32971-1-AP) by Proteintech is a Polyclonal antibody targeting RBPMS2 in WB, ELISA applications with reactivity to human samples 32971-1-AP targets RBPMS2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, L02 cells, PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RBPMS2 (RNA binding protein with multiple splicing 2) is an RNA binding protein, and its encoded protein is rich in RNA binding motifs, belonging to the family of RNA binding motifs, and has an RNA recognition motif (RRM) domain, which can bind with RNA molecules and participate in RNA regulation. RBPMS2 is abundant in myocardial cells and plays an important role in the development and function of myocardium. It can regulate the differentiation and proliferation of myocardial cells and maintain the normal function of myocardial cells. In gastric cancer, the expression level of RBPMS2 is related to lymph node metastasis, which can be used as a biomarker to predict the prognosis of gastric cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37616 Product name: Recombinant human RBPMS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-207 aa of NM_194272 Sequence: SKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC Predict reactive species Full Name: RNA binding protein with multiple splicing 2 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 24 kDa, 26-29 kDa GenBank Accession Number: NM_194272 Gene Symbol: RBPMS2 Gene ID (NCBI): 348093 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZRY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924