Iright
BRAND / VENDOR: Proteintech

Proteintech, 32984-1-AP, GGN Polyclonal antibody

CATALOG NUMBER: 32984-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GGN (32984-1-AP) by Proteintech is a Polyclonal antibody targeting GGN in WB, ELISA applications with reactivity to human samples 32984-1-AP targets GGN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Calu-1 cells, A549 cells, HT-1080 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Human gametogenetin (GGN) is expressed in the testis and ovaries and is a conserved gene in human and mouse. Recently, GGN was found to play a tumor-promoting role in cancer through regulation of NFκB/caspase-3-mediated apoptosis signaling (PMID: 30721393). GGN can be glycosylated, which may result in an increase in observed molecular weight. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38372 Product name: Recombinant human GGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-381 aa of NM_152657.3 Sequence: TESQAGPRNQGQTAGRARGGAPPHAGEGEMAQPADSESGLSLLCKITFKSRPSLAPPAASSSLAAKASLGGGGGGGLFAASGAISYAEVLKQGPLPPGAARPLGEVSRGAQEAEGGDGDGEGCSGPPSAPASQARALPPPPYTTFPGSKPKFDWVSAPDGPERHFRFNGAGGGIGAPRRRAA Predict reactive species Full Name: gametogenetin Calculated Molecular Weight: 67kDa,652aa Observed Molecular Weight: 65 kDa, 70 kDa GenBank Accession Number: NM_152657.3 Gene Symbol: GGN Gene ID (NCBI): 199720 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86UU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924