Proteintech, 33022-1-AP, B3GALT5 Polyclonal antibody

Size: 20ul / 150ul The B3GALT5 (33022-1-AP) by Proteintech is a Polyclonal antibody targeting B3GALT5 in WB, ELISA applications with reactivity to human, mouse, rat samples 33022-1-AP targets B3GALT5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse small intestine tissue, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information B3GALT5 (β-1,3-galactosyltransferase 5) is a key glycosyltransferase enzyme. It is responsible for catalyzing the synthesis of the terminal glycan structure, the sialyl Lewis X antigen. This antigen serves as an important ligand for selectin family proteins, mediating cell adhesion in both physiological and pathological processes. Its core function lies in regulating cell migration. In immunology, it influences lymphocyte homing; in oncology, its aberrant upregulation promotes the synthesis of sLe^x, leading to the adhesion of cancer cells to vascular endothelium via the "selectin-ligand" recognition system. This represents a critical initial step in tumor hematogenous metastasis, such as to the liver or lungs. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37977 Product name: Recombinant human B3GALT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-310 aa of BC104862 Sequence: NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV Predict reactive species Full Name: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 Calculated Molecular Weight: 310 aa, 36 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC104862 Gene Symbol: B3GALT5 Gene ID (NCBI): 10317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y2C3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.