Iright
BRAND / VENDOR: Proteintech

Proteintech, 33028-1-AP, PLEKHN1 Polyclonal antibody

CATALOG NUMBER: 33028-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLEKHN1 (33028-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 33028-1-AP targets PLEKHN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HT-29 cells, mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PLEKHN1 (Pleckstrin Homology Domain Containing N1) is a protein-coding gene located on chromosome 1. It plays a crucial role in various cellular processes, including apoptosis and mRNA stability regulation. PLEKHN1 has been identified as a pro-apoptotic protein that enhances Bax-Bak hetero-oligomerization via interaction with Bid in colon cancer cells. (PMID: 29531808) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38741 Product name: Recombinant human PLEKHN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-350 aa of BC101386 Sequence: SAPPQGSCGDELPWTLQRRLTRLRTASGHEPGGSAVCASRVKLQHLPAQEQWDRLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCASYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGS Predict reactive species Full Name: pleckstrin homology domain containing, family N member 1 Calculated Molecular Weight: 663 aa, 72 kDa Observed Molecular Weight: 66-71 kDa GenBank Accession Number: BC101386 Gene Symbol: PLEKHN1 Gene ID (NCBI): 84069 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q494U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924