Product Description
Size: 20ul / 150ul
The CHTF8 (33030-1-AP) by Proteintech is a Polyclonal antibody targeting CHTF8 in WB, ELISA applications with reactivity to human samples
33030-1-AP targets CHTF8 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, MKN-45 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
CHTF8 (C-terminal binding protein Transcriptional co-Factor 8) is a crucial protein that serves as a core component of the chromatin assembly factor-1 (CAF-1) complex.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag39083 Product name: Recombinant human CHTF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC018700 Sequence: MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV Predict reactive species
Full Name: CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC018700
Gene Symbol: CHTF8
Gene ID (NCBI): 54921
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P0CG13
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924