Iright
BRAND / VENDOR: Proteintech

Proteintech, 33038-1-AP, TPRG1L Polyclonal antibody

CATALOG NUMBER: 33038-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TPRG1L (33038-1-AP) by Proteintech is a Polyclonal antibody targeting TPRG1L in WB, ELISA applications with reactivity to human, mouse, rat samples 33038-1-AP targets TPRG1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, SK-N-SH cells, mouse kidney tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37863 Product name: Recombinant human TPRG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC019034 Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI Predict reactive species Full Name: tumor protein p63 regulated 1-like Observed Molecular Weight: 31 kDa GenBank Accession Number: BC019034 Gene Symbol: TPRG1L Gene ID (NCBI): 127262 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5T0D9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924