Proteintech, 33044-1-AP, FAM166A Polyclonal antibody

Size: 20ul / 150ul The FAM166A (33044-1-AP) by Proteintech is a Polyclonal antibody targeting FAM166A in WB, ELISA applications with reactivity to human, mouse samples 33044-1-AP targets FAM166A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37804 Product name: Recombinant human CIMIP2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of NM_001001710 Sequence: MTTTQKHDLFTPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIPHYTSLKPSKNFEILGQLPPLEVDAQEPPGVENIPRQILLPAGFTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQRLPQLDHPNL Predict reactive species Full Name: family with sequence similarity 166, member A Calculated Molecular Weight: 317aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: NM_001001710 Gene Symbol: FAM166A Gene ID (NCBI): 401565 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6J272 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.