Iright
BRAND / VENDOR: Proteintech

Proteintech, 33074-1-AP, Carboxypeptidase A Polyclonal antibody

CATALOG NUMBER: 33074-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Carboxypeptidase A (33074-1-AP) by Proteintech is a Polyclonal antibody targeting Carboxypeptidase A in WB, ELISA applications with reactivity to mouse, rat samples 33074-1-AP targets Carboxypeptidase A in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Carboxypeptidases (CPs) are a type of exonuclease that specifically degrades and releases free amino acids from the C-terminal of a peptide chain one by one. Carboxypeptidase A: It hydrolyzes the carboxyl terminus formed by aromatic and neutral aliphatic amino acids. For example, tyrosine, phenylalanine, alanine, etc. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg3276 Product name: Recombinant Rat Carboxypeptidase A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-419 aa of NM_016998.3 Sequence: NENFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRDAARAGIPIDVRVPFPSIQSVKAFLEYHGISYEIMIEDVQLLLDEEKQQMSAFQARALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY Predict reactive species Full Name: carboxypeptidase A1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_016998.3 Gene Symbol: Cpa1 Gene ID (NCBI): 24269 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P00731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924